PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400063267
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family BES1
Protein Properties Length: 183aa    MW: 20634.2 Da    PI: 8.1236
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400063267genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822110.62.6e-3436104472
                DUF822   4 grkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkg 72 
                            r p+ +Er +nk+RE+ RR +a ki+aGLRa+Gnyklpk+aD n+ l ALc+eAGw ve+DGt   k 
  PGSC0003DMP400063267  36 FRYPSDRERQKNKQREKNRRRVAHKIFAGLRAHGNYKLPKHADTNDLLMALCKEAGWHVEEDGTINGKD 104
                           5899************************************************************86654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.8E-3137107IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MVEDKKTSGV RGCIKTSRGP WLVHRTAKDG SVVTRFRYPS DRERQKNKQR EKNRRRVAHK  60
IFAGLRAHGN YKLPKHADTN DLLMALCKEA GWHVEEDGTI NGKDPVKDLP RLIDVDSAQV  120
SMEDQTKDGD YCKCEDQLKD GEYYCKCEVE MNKVESEKGR PEGSLTSSAE VFDVNLTLSL  180
SS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754491e-147HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010327721.11e-125PREDICTED: protein BRASSINAZOLE-RESISTANT 2-like
TrEMBLM1DMZ21e-135M1DMZ2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000915921e-134(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62042130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.33e-16BES1 family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]